Lineage for d1h4ia_ (1h4i A:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 62941Fold b.70: 8-bladed beta-propeller [50997] (2 superfamilies)
  4. 62942Superfamily b.70.1: Quinoprotein alcohol dehydrogenase [50998] (1 family) (S)
  5. 62943Family b.70.1.1: Quinoprotein alcohol dehydrogenase [50999] (2 proteins)
  6. 62948Protein Methanol dehydrogenase, heavy chain [51000] (2 species)
  7. 62949Species Methylobacterium extorquens [TaxId:408] [63834] (2 PDB entries)
  8. 62950Domain d1h4ia_: 1h4i A: [60586]
    Other proteins in same PDB: d1h4ib_, d1h4id_

Details for d1h4ia_

PDB Entry: 1h4i (more details), 1.94 Å

PDB Description: methylobacterium extorquens methanol dehydrogenase

SCOP Domain Sequences for d1h4ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h4ia_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens}
ndklvelsksddnwvmpgknydsnnfsdlkqinkgnvkqlrpawtfstgllnghegaplv
vdgkmyihtsfpnntfalglddpgtilwqdkpkqnpaaravaccdlvnrglaywpgdgkt
palilktqldgnvaalnaetgetvwkvensdikvgstltiapyvvkdkviigssgaelgv
rgyltaydvktgeqvwrayatgpdkdlllasdfniknphygqkglgtgtwegdawkiggg
tnwgwyaydpgtnliyfgtgnpapwnetmrpgdnkwtmtifgrdadtgeakfgyqktphd
ewdyagvnvmmlseqkdkdgkarkllthpdrngivytldrtdgalvsanklddtvnvfks
vdlktgqpvrdpeygtrmdhlakdicpsamgyhnqghdsydpkrelffmginhicmdwep
fmlpyragqffvgatlnmypgpkgdrqnyeglgqikaynaitgdykwekmerfavwggtm
atagdlvfygtldgylkardsdtgdllwkfkipsgaigypmtythkgtqyvaiyygvggw
pgvglvfdladptaglgavgafkklanytqmgggvvvfsldgkgpyddpnvgewk

SCOP Domain Coordinates for d1h4ia_:

Click to download the PDB-style file with coordinates for d1h4ia_.
(The format of our PDB-style files is described here.)

Timeline for d1h4ia_: