Lineage for d1h4ia_ (1h4i A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2066579Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 2066580Superfamily b.70.1: Quinoprotein alcohol dehydrogenase-like [50998] (2 families) (S)
  5. 2066581Family b.70.1.1: Quinoprotein alcohol dehydrogenase-like [50999] (4 protein domains)
  6. 2066588Protein Methanol dehydrogenase, heavy chain [51000] (3 species)
  7. 2066589Species Methylobacterium extorquens [TaxId:408] [63834] (3 PDB entries)
    Uniprot P16027
  8. 2066592Domain d1h4ia_: 1h4i A: [60586]
    Other proteins in same PDB: d1h4ib_, d1h4id_
    complexed with ca, pqq

Details for d1h4ia_

PDB Entry: 1h4i (more details), 1.94 Å

PDB Description: methylobacterium extorquens methanol dehydrogenase
PDB Compounds: (A:) methanol dehydrogenase subunit 1

SCOPe Domain Sequences for d1h4ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h4ia_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]}
ndklvelsksddnwvmpgknydsnnfsdlkqinkgnvkqlrpawtfstgllnghegaplv
vdgkmyihtsfpnntfalglddpgtilwqdkpkqnpaaravaccdlvnrglaywpgdgkt
palilktqldgnvaalnaetgetvwkvensdikvgstltiapyvvkdkviigssgaelgv
rgyltaydvktgeqvwrayatgpdkdlllasdfniknphygqkglgtgtwegdawkiggg
tnwgwyaydpgtnliyfgtgnpapwnetmrpgdnkwtmtifgrdadtgeakfgyqktphd
ewdyagvnvmmlseqkdkdgkarkllthpdrngivytldrtdgalvsanklddtvnvfks
vdlktgqpvrdpeygtrmdhlakdicpsamgyhnqghdsydpkrelffmginhicmdwep
fmlpyragqffvgatlnmypgpkgdrqnyeglgqikaynaitgdykwekmerfavwggtm
atagdlvfygtldgylkardsdtgdllwkfkipsgaigypmtythkgtqyvaiyygvggw
pgvglvfdladptaglgavgafkklanytqmgggvvvfsldgkgpyddpnvgewk

SCOPe Domain Coordinates for d1h4ia_:

Click to download the PDB-style file with coordinates for d1h4ia_.
(The format of our PDB-style files is described here.)

Timeline for d1h4ia_: