Lineage for d1gjta_ (1gjt A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 352714Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (6 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 352715Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (2 families) (S)
  5. 352735Family a.8.1.2: GA module, an albumin-binding domain [47001] (2 proteins)
  6. 352736Protein IgG binding protein G [63496] (1 species)
  7. 352737Species Streptococcus sp., group G [TaxId:1306] [63497] (2 PDB entries)
  8. 352739Domain d1gjta_: 1gjt A: [60579]

Details for d1gjta_

PDB Entry: 1gjt (more details)

PDB Description: solution structure of the albumin binding domain of streptococcal protein g

SCOP Domain Sequences for d1gjta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gjta_ a.8.1.2 (A:) IgG binding protein G {Streptococcus sp., group G}
mkaifvlnaqhdeavdanslaeakvlanreldkygvsdyyknlinnaktvegvkalidei
laalp

SCOP Domain Coordinates for d1gjta_:

Click to download the PDB-style file with coordinates for d1gjta_.
(The format of our PDB-style files is described here.)

Timeline for d1gjta_: