Lineage for d1gjta_ (1gjt A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696962Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 2696963Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families) (S)
  5. 2697104Family a.8.1.2: GA module, an albumin-binding domain [47001] (4 proteins)
    Pfam PF01468; also includes FIVAR module, Pfam PF07554
  6. 2697115Protein IgG binding protein G [63496] (1 species)
  7. 2697116Species Streptococcus sp., group G [TaxId:1306] [63497] (2 PDB entries)
  8. 2697117Domain d1gjta_: 1gjt A: [60579]

Details for d1gjta_

PDB Entry: 1gjt (more details)

PDB Description: solution structure of the albumin binding domain of streptococcal protein g
PDB Compounds: (A:) immunoglobulin g binding protein g

SCOPe Domain Sequences for d1gjta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gjta_ a.8.1.2 (A:) IgG binding protein G {Streptococcus sp., group G [TaxId: 1306]}
mkaifvlnaqhdeavdanslaeakvlanreldkygvsdyyknlinnaktvegvkalidei
laalp

SCOPe Domain Coordinates for d1gjta_:

Click to download the PDB-style file with coordinates for d1gjta_.
(The format of our PDB-style files is described here.)

Timeline for d1gjta_: