SCOPe 2.05: Domain d1gjsa_: 1gjs A:

Lineage for d1gjsa_ (1gjs A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold

4. Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families)

5. Family a.8.1.2: GA module, an albumin-binding domain [47001] (4 proteins)
   Pfam PF01468; also includes FIVAR module, Pfam PF07554

6. Protein IgG binding protein G [63496] (1 species)

7. Species Streptococcus sp., group G [TaxId:1306] [63497] (2 PDB entries)

8. Domain d1gjsa_: 1gjs A: [60578]

Details for d1gjsa_

PDB Entry: 1gjs

PDB Description: solution structure of the albumin binding domain of streptococcal protein g

PDB Compounds: (A:) immunoglobulin g binding protein g

SCOPe Domain Sequences for d1gjsa_:

Sequence; same for both SEQRES and ATOM records:

>d1gjsa_ a.8.1.2 (A:) IgG binding protein G {Streptococcus sp., group G [TaxId: 1306]}
mkaifvlnaqhdeavdanslaeakvlanreldkygvsdyyknlinnaktvegvkalidei
laalp

Timeline for d1gjsa_:

• d1gjsa_ first appeared in SCOP 1.57
  
• d1gjsa_ appears in SCOPe 2.04
  
• d1gjsa_ appears in SCOPe 2.06
  
• d1gjsa_ appears in the current release, SCOPe 2.08