Lineage for d1gjpa_ (1gjp A:)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies) 
Superfamily c.1.10: Aldolase [51569] (4 families) 
Family c.1.10.3: 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51594] (1 protein) Protein 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51595] (4 species) 
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51596] (10 PDB entries) 
Domain d1gjpa_: 1gjp A: [60577]
Details for d1gjpa_
PDB Entry: 1gjp (more details), 1.8 Å
PDB Description: schiff-base complex of yeast 5-aminolaevulinic acid dehydratase with 4-oxosebacic acid
SCOP Domain Sequences for d1gjpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gjpa_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Baker's yeast (Saccharomyces cerevisiae)}
mhtaefletepteissvlaggynhpllrqwqserqltknmlifplfisdnpddfteidsl
pninrigvnrlkdylkplvakglrsvilfgvplipgtkdpvgtaaddpagpviqgikfir
eyfpelyiicdvclceytshghcgvlyddgtinrersvsrlaavavnyakagahcvapsd
midgrirdikrglinanlahktfvlsyaakfsgnlygpfrdaacsapsngdrkcyqlppa
grglarralerdmsegadgiivkpstfyldimrdaseickdlpicayhvsgeyamlhaaa
ekgvvdlktiafeshqgflragarliitylapefldwlde
SCOP Domain Coordinates for d1gjpa_:
Click to download the PDB-style file with coordinates for d1gjpa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gjpa_:
- d1gjpa_ is new in SCOP 1.57
- d1gjpa_ appears in SCOP 1.59
- d1gjpa_ appears in the current release, SCOPe 2.08
View in 3D