Lineage for d1giyu_ (1giy U:)

  1. Root: SCOP 1.67
  2. 432183Class i: Low resolution protein structures [58117] (22 folds)
  3. 432184Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 432185Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 432186Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 432187Protein 70S ribosome functional complex [58121] (2 species)
  7. 432472Species Thermus thermophilus [TaxId:274] [58122] (10 PDB entries)
  8. 432598Domain d1giyu_: 1giy U: [60568]

Details for d1giyu_

PDB Entry: 1giy (more details), 5.5 Å

PDB Description: crystal structure of the ribosome at 5.5 a resolution. this file, 1giy, contains the 50s ribosome subunit. the 30s ribosome subunit, three trna, and mrna molecules are in the file 1gix

SCOP Domain Sequences for d1giyu_:

Sequence, based on SEQRES records: (download)

>d1giyu_ i.1.1.1 (U:) 70S ribosome functional complex {Thermus thermophilus}
skqpdkqrksqrraplherhkqvratlsadlreeygqrnvrvnagdtvevlrgdfageeg
evinvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearle

Sequence, based on observed residues (ATOM records): (download)

>d1giyu_ i.1.1.1 (U:) 70S ribosome functional complex {Thermus thermophilus}
skqpdkqrksqrraplherhkqvratlsadlreeygvrvnagdtvevlrgdfageegevi
nvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearle

SCOP Domain Coordinates for d1giyu_:

Click to download the PDB-style file with coordinates for d1giyu_.
(The format of our PDB-style files is described here.)

Timeline for d1giyu_: