Lineage for d1giyt_ (1giy T:)

  1. Root: SCOP 1.69
  2. 526321Class i: Low resolution protein structures [58117] (24 folds)
  3. 526322Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 526323Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 526324Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 526325Protein 70S ribosome functional complex [58121] (3 species)
  7. 526664Species Thermus thermophilus [TaxId:274] [58122] (10 PDB entries)
  8. 526789Domain d1giyt_: 1giy T: [60567]

Details for d1giyt_

PDB Entry: 1giy (more details), 5.5 Å

PDB Description: crystal structure of the ribosome at 5.5 a resolution. this file, 1giy, contains the 50s ribosome subunit. the 30s ribosome subunit, three trna, and mrna molecules are in the file 1gix

SCOP Domain Sequences for d1giyt_:

Sequence, based on SEQRES records: (download)

>d1giyt_ i.1.1.1 (T:) 70S ribosome functional complex {Thermus thermophilus}
swdvikhphvtekamndmdfqnklqfavddraskgevadaveeqydvtveqvntqntmdg
ekkavvrlsedddaqeva

Sequence, based on observed residues (ATOM records): (download)

>d1giyt_ i.1.1.1 (T:) 70S ribosome functional complex {Thermus thermophilus}
swdvikhphvtekamndmdfnklqfavddraskgevadaveeqydvtveqvntqntmdge
kkavvrlsedddqeva

SCOP Domain Coordinates for d1giyt_:

Click to download the PDB-style file with coordinates for d1giyt_.
(The format of our PDB-style files is described here.)

Timeline for d1giyt_: