Lineage for d1giyn_ (1giy N:)

  1. Root: SCOP 1.65
  2. 345885Class i: Low resolution protein structures [58117] (18 folds)
  3. 345886Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 345887Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 345888Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 345889Protein 70S ribosome functional complex [58121] (2 species)
  7. 346163Species Thermus thermophilus [TaxId:274] [58122] (10 PDB entries)
  8. 346282Domain d1giyn_: 1giy N: [60561]

Details for d1giyn_

PDB Entry: 1giy (more details), 5.5 Å

PDB Description: crystal structure of the ribosome at 5.5 a resolution. this file, 1giy, contains the 50s ribosome subunit. the 30s ribosome subunit, three trna, and mrna molecules are in the file 1gix

SCOP Domain Sequences for d1giyn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1giyn_ i.1.1.1 (N:) 70S ribosome functional complex {Thermus thermophilus}
miqqesrlkvadnsgarevlvikvlggsgrryanigdvvvatvkdatpggvvkkgqvvka
vvvrtkrgvrrpdgsyirfdenacviirddksprgtrifgpvarelrdkdfmkiislape
vi

SCOP Domain Coordinates for d1giyn_:

Click to download the PDB-style file with coordinates for d1giyn_.
(The format of our PDB-style files is described here.)

Timeline for d1giyn_: