Class i: Low resolution protein structures [58117] (25 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.1: Ribosome complexes [58120] (1 protein) |
Protein 70S ribosome functional complex [58121] (9 species) |
Species Thermus thermophilus [TaxId:274] [58122] (21 PDB entries) |
Domain d1giym_: 1giy M: [60560] |
PDB Entry: 1giy (more details), 5.5 Å
SCOPe Domain Sequences for d1giym_:
Sequence, based on SEQRES records: (download)
>d1giym_ i.1.1.1 (M:) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]} aefdadvivdardcimgrvasqvaeqaldgetvavvnaeravitgreeqivekyekrvdi gndngyfypkrpdgifkrtirgmlphkkqrgreafesvrvylgnpydedgevldgtsldr lsnikfvtlgeisetlga
>d1giym_ i.1.1.1 (M:) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]} aefdadvivdardcimgrvasqvaeqaldgetvavvnaeravitgreeqivekyekrvdi gndngyfypkrpdgifkrtirgmlpkkqrgreafesvrvylgnpydtlgeisetlga
Timeline for d1giym_: