Lineage for d1giyj_ (1giy J:)

  1. Root: SCOPe 2.05
  2. 1970697Class i: Low resolution protein structures [58117] (25 folds)
  3. 1970698Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1970699Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1970700Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. 1970701Protein 70S ribosome functional complex [58121] (4 species)
  7. 1971258Species Thermus thermophilus [TaxId:274] [58122] (20 PDB entries)
  8. 1971378Domain d1giyj_: 1giy J: [60557]

Details for d1giyj_

PDB Entry: 1giy (more details), 5.5 Å

PDB Description: crystal structure of the ribosome at 5.5 a resolution. this file, 1giy, contains the 50s ribosome subunit. the 30s ribosome subunit, three trna, and mrna molecules are in the file 1gix
PDB Compounds: (J:) 50S ribosomal protein L7/L12

SCOPe Domain Sequences for d1giyj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1giyj_ i.1.1.1 (J:) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
mtideiieaiekltvselaelvkkledkfgvtaaapvavaaapvagaaagaaqeektefd
vvlksfgqnkiqvikvvreitglglkeakdlvekagspdaviksgvskeeaeeikkklee
agaevelk

SCOPe Domain Coordinates for d1giyj_:

Click to download the PDB-style file with coordinates for d1giyj_.
(The format of our PDB-style files is described here.)

Timeline for d1giyj_: