Lineage for d1giyj_ (1giy J:)

  1. Root: SCOP 1.71
  2. 627044Class i: Low resolution protein structures [58117] (24 folds)
  3. 627045Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 627046Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 627047Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 627048Protein 70S ribosome functional complex [58121] (3 species)
  7. 627637Species Thermus thermophilus [TaxId:274] [58122] (10 PDB entries)
  8. 627752Domain d1giyj_: 1giy J: [60557]

Details for d1giyj_

PDB Entry: 1giy (more details), 5.5 Å

PDB Description: crystal structure of the ribosome at 5.5 a resolution. this file, 1giy, contains the 50s ribosome subunit. the 30s ribosome subunit, three trna, and mrna molecules are in the file 1gix

SCOP Domain Sequences for d1giyj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1giyj_ i.1.1.1 (J:) 70S ribosome functional complex {Thermus thermophilus}
mtideiieaiekltvselaelvkkledkfgvtaaapvavaaapvagaaagaaqeektefd
vvlksfgqnkiqvikvvreitglglkeakdlvekagspdaviksgvskeeaeeikkklee
agaevelk

SCOP Domain Coordinates for d1giyj_:

Click to download the PDB-style file with coordinates for d1giyj_.
(The format of our PDB-style files is described here.)

Timeline for d1giyj_: