Lineage for d1giyc_ (1giy C:)

  1. Root: SCOPe 2.02
  2. 1248417Class i: Low resolution protein structures [58117] (25 folds)
  3. 1248418Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1248419Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1248420Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 1248421Protein 70S ribosome functional complex [58121] (9 species)
  7. 1249067Species Thermus thermophilus [TaxId:274] [58122] (21 PDB entries)
  8. 1249152Domain d1giyc_: 1giy C: [60550]

Details for d1giyc_

PDB Entry: 1giy (more details), 5.5 Å

PDB Description: crystal structure of the ribosome at 5.5 a resolution. this file, 1giy, contains the 50s ribosome subunit. the 30s ribosome subunit, three trna, and mrna molecules are in the file 1gix
PDB Compounds: (C:) 50s ribosomal protein l1

SCOPe Domain Sequences for d1giyc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1giyc_ i.1.1.1 (C:) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
kryrallekvdpnkiytideaahlvkelatakfdetvevhaklgidprrsdqnvrgtvsl
phglgkqvrvlaiakgekikeaeeagadyvggeeiiqkildgwmdfdavvatpdvmgavg
sklgrilgprgllpnpkagtvgfnigeiireikagriefrndktgaihapvgkasfppek
ladnirafiraleahkpegakgtflrsvyvtttmgpsvrinphs

SCOPe Domain Coordinates for d1giyc_:

Click to download the PDB-style file with coordinates for d1giyc_.
(The format of our PDB-style files is described here.)

Timeline for d1giyc_: