Lineage for d1gixw_ (1gix W:)

  1. Root: SCOPe 2.04
  2. 1710350Class i: Low resolution protein structures [58117] (25 folds)
  3. 1710351Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1710352Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1710353Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 1710354Protein 70S ribosome functional complex [58121] (9 species)
  7. 1711001Species Thermus thermophilus [TaxId:274] [58122] (20 PDB entries)
  8. Domain d1gixw_: 1gix W: [60546]

Details for d1gixw_

PDB Entry: 1gix (more details), 5.5 Å

PDB Description: Crystal structure of the ribosome at 5.5 A resolution. This file, 1GIX, contains the 30S ribosome subunit, three tRNA, and mRNA molecules. 50S ribosome subunit is in the file 1GIY
PDB Compounds: (W:) 30S ribosomal protein S20

SCOPe Domain Sequences for d1gixw_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gixw_ i.1.1.1 (W:) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
rnlsalkrhrqslkrrlrnkakksaiktlskkavqlaqegkaeealkimrkaeslidkaa
kgstlhknaaarrksrlmrkvrqlleaagapliggglsa

SCOPe Domain Coordinates for d1gixw_:

Click to download the PDB-style file with coordinates for d1gixw_.
(The format of our PDB-style files is described here.)

Timeline for d1gixw_: