SCOP 1.69: Domain d1gixq_: 1gix Q:

Lineage for d1gixq_ (1gix Q:)

1. Root: SCOP 1.69

2. Class i: Low resolution protein structures [58117] (24 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.1: Ribosome complexes [58120] (1 protein)

6. Protein 70S ribosome functional complex [58121] (3 species)

7. Species Thermus thermophilus [TaxId:274] [58122] (10 PDB entries)

8. Domain d1gixq_: 1gix Q: [60540]

Details for d1gixq_

PDB Entry: 1gix, 5.5 Å

PDB Description: Crystal structure of the ribosome at 5.5 A resolution. This file, 1GIX, contains the 30S ribosome subunit, three tRNA, and mRNA molecules. 50S ribosome subunit is in the file 1GIY

SCOP Domain Sequences for d1gixq_:

Sequence; same for both SEQRES and ATOM records:

>d1gixq_ i.1.1.1 (Q:) 70S ribosome functional complex {Thermus thermophilus}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw

Timeline for d1gixq_:

• d1gixq_ first appeared in SCOP 1.57
  
• d1gixq_ appears in SCOP 1.67
  
• d1gixq_ appears in SCOP 1.71
  
• d1gixq_ appears in the current release, SCOPe 2.08