Lineage for d1gixo_ (1gix O:)

  1. Root: SCOP 1.75
  2. 896322Class i: Low resolution protein structures [58117] (26 folds)
  3. 896323Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 896324Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 896325Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 896326Protein 70S ribosome functional complex [58121] (9 species)
  7. 896972Species Thermus thermophilus [TaxId:274] [58122] (21 PDB entries)
  8. 897097Domain d1gixo_: 1gix O: [60538]

Details for d1gixo_

PDB Entry: 1gix (more details), 5.5 Å

PDB Description: Crystal structure of the ribosome at 5.5 A resolution. This file, 1GIX, contains the 30S ribosome subunit, three tRNA, and mRNA molecules. 50S ribosome subunit is in the file 1GIY
PDB Compounds: (O:) 30S ribosomal protein S12

SCOP Domain Sequences for d1gixo_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gixo_ i.1.1.1 (O:) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy
evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk
pkea

SCOP Domain Coordinates for d1gixo_:

Click to download the PDB-style file with coordinates for d1gixo_.
(The format of our PDB-style files is described here.)

Timeline for d1gixo_: