Lineage for d1gixh_ (1gix H:)

  1. Root: SCOPe 2.03
  2. 1467789Class i: Low resolution protein structures [58117] (25 folds)
  3. 1467790Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1467791Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1467792Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 1467793Protein 70S ribosome functional complex [58121] (9 species)
  7. 1468440Species Thermus thermophilus [TaxId:274] [58122] (20 PDB entries)
  8. 1468578Domain d1gixh_: 1gix H: [60531]

Details for d1gixh_

PDB Entry: 1gix (more details), 5.5 Å

PDB Description: Crystal structure of the ribosome at 5.5 A resolution. This file, 1GIX, contains the 30S ribosome subunit, three tRNA, and mRNA molecules. 50S ribosome subunit is in the file 1GIY
PDB Compounds: (H:) 30S ribosomal protein S5

SCOPe Domain Sequences for d1gixh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gixh_ i.1.1.1 (H:) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
dfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyyarr
nmvevplqngtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelg
srnpiniayatmealrqlrtkadverlrkg

SCOPe Domain Coordinates for d1gixh_:

Click to download the PDB-style file with coordinates for d1gixh_.
(The format of our PDB-style files is described here.)

Timeline for d1gixh_: