Lineage for d1ghqc2 (1ghq C:67-134)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 749292Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 749293Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family) (S)
  5. 749294Family g.18.1.1: Complement control module/SCR domain [57536] (13 proteins)
    Pfam PF00084
  6. 749483Protein Complement receptor 2, cr2 [64564] (1 species)
  7. 749484Species Human (Homo sapiens) [TaxId:9606] [64565] (4 PDB entries)
  8. 749490Domain d1ghqc2: 1ghq C:67-134 [60525]
    Other proteins in same PDB: d1ghqa_
    complexed with C3D
    complexed with nag, zn; mutant

Details for d1ghqc2

PDB Entry: 1ghq (more details), 2.04 Å

PDB Description: cr2-c3d complex structure
PDB Compounds: (C:) cr2/cd121/c3d/epstein-barr virus receptor

SCOP Domain Sequences for d1ghqc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ghqc2 g.18.1.1 (C:67-134) Complement receptor 2, cr2 {Human (Homo sapiens) [TaxId: 9606]}
nkysscpepivpggykirgstpyrhgdsvtfacktnfsmngnksvwcqannmwgptrlpt
cvsvfple

SCOP Domain Coordinates for d1ghqc2:

Click to download the PDB-style file with coordinates for d1ghqc2.
(The format of our PDB-style files is described here.)

Timeline for d1ghqc2: