Lineage for d1ghqb2 (1ghq B:67-129)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2260769Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 2260770Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) (S)
  5. 2260771Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
    Pfam PF00084
  6. 2260967Protein Complement receptor 2, cr2 [64564] (1 species)
  7. 2260968Species Human (Homo sapiens) [TaxId:9606] [64565] (4 PDB entries)
  8. 2260972Domain d1ghqb2: 1ghq B:67-129 [60523]
    Other proteins in same PDB: d1ghqa1, d1ghqa2, d1ghqb3, d1ghqc3
    complexed with C3D
    complexed with ndg, zn

Details for d1ghqb2

PDB Entry: 1ghq (more details), 2.04 Å

PDB Description: cr2-c3d complex structure
PDB Compounds: (B:) cr2/cd121/c3d/epstein-barr virus receptor

SCOPe Domain Sequences for d1ghqb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ghqb2 g.18.1.1 (B:67-129) Complement receptor 2, cr2 {Human (Homo sapiens) [TaxId: 9606]}
nkysscpepivpggykirgstpyrhgdsvtfacktnfsmngnksvwcqannmwgptrlpt
cvs

SCOPe Domain Coordinates for d1ghqb2:

Click to download the PDB-style file with coordinates for d1ghqb2.
(The format of our PDB-style files is described here.)

Timeline for d1ghqb2: