![]() | Class g: Small proteins [56992] (90 folds) |
![]() | Fold g.18: Complement control module/SCR domain [57534] (1 superfamily) disulfide-rich all-beta fold |
![]() | Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family) ![]() |
![]() | Family g.18.1.1: Complement control module/SCR domain [57536] (14 proteins) Pfam PF00084 |
![]() | Protein Complement receptor 2, cr2 [64564] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [64565] (4 PDB entries) |
![]() | Domain d1ghqb2: 1ghq B:67-129 [60523] Other proteins in same PDB: d1ghqa_ complexed with C3D |
PDB Entry: 1ghq (more details), 2.04 Å
SCOP Domain Sequences for d1ghqb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ghqb2 g.18.1.1 (B:67-129) Complement receptor 2, cr2 {Human (Homo sapiens) [TaxId: 9606]} nkysscpepivpggykirgstpyrhgdsvtfacktnfsmngnksvwcqannmwgptrlpt cvs
Timeline for d1ghqb2: