Lineage for d1ghqb1 (1ghq B:1-66)

  1. Root: SCOP 1.67
  2. 427008Class g: Small proteins [56992] (72 folds)
  3. 429210Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 429211Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family) (S)
  5. 429212Family g.18.1.1: Complement control module/SCR domain [57536] (9 proteins)
  6. 429371Protein Complement receptor 2, cr2 [64564] (1 species)
  7. 429372Species Human (Homo sapiens) [TaxId:9606] [64565] (2 PDB entries)
  8. 429375Domain d1ghqb1: 1ghq B:1-66 [60522]
    Other proteins in same PDB: d1ghqa_

Details for d1ghqb1

PDB Entry: 1ghq (more details), 2.04 Å

PDB Description: cr2-c3d complex structure

SCOP Domain Sequences for d1ghqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ghqb1 g.18.1.1 (B:1-66) Complement receptor 2, cr2 {Human (Homo sapiens)}
aiscgspppilngrisyystpiavgtviryscsgtfrligeksllcitkdkvdgtwdkpa
pkceyf

SCOP Domain Coordinates for d1ghqb1:

Click to download the PDB-style file with coordinates for d1ghqb1.
(The format of our PDB-style files is described here.)

Timeline for d1ghqb1:

429375
d1ghqb1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1ghqb2