![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.102: alpha/alpha toroid [48207] (6 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
![]() | Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) ![]() |
![]() | Family a.102.4.4: Complement components [48251] (4 proteins) probably related to other families, but has no known enzymatic activity |
![]() | Protein Thio-ester containing domain (TED) from Complement C3, aka C3d or C3dg [48252] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [48253] (17 PDB entries) |
![]() | Domain d1ghqa1: 1ghq A:3-307 [60521] Other proteins in same PDB: d1ghqa2, d1ghqb1, d1ghqb2, d1ghqb3, d1ghqc1, d1ghqc2, d1ghqc3 complexed with ndg, zn |
PDB Entry: 1ghq (more details), 2.04 Å
SCOPe Domain Sequences for d1ghqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ghqa1 a.102.4.4 (A:3-307) Thio-ester containing domain (TED) from Complement C3, aka C3d or C3dg {Human (Homo sapiens) [TaxId: 9606]} daerlkhlivtpsgageqnmigmtptviavhyldeteqwekfglekrqgalelikkgytq qlafrqpssafaafvkrapstwltayvvkvfslavnliaidsqvlcgavkwlilekqkpd gvfqedapvihqemigglrnnnekdmaltafvlislqeakdiceeqvnslpgsitkagdf leanymnlqrsytvaiagyalaqmgrlkgpllnkflttakdknrwedpgkqlynveatsy allallqlkdfdfvppvvrwlneqryygggygstqatfmvfqalaqyqkdapsdhqelnl dvslq
Timeline for d1ghqa1: