Lineage for d1ghqa_ (1ghq A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1742882Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 1743246Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 1743519Family a.102.4.4: Complement components [48251] (4 proteins)
    probably related to other families, but has no known enzymatic activity
  6. 1743523Protein Thio-ester containing domain (TED) from Complement C3, aka C3d or C3dg [48252] (2 species)
  7. 1743524Species Human (Homo sapiens) [TaxId:9606] [48253] (16 PDB entries)
  8. 1743528Domain d1ghqa_: 1ghq A: [60521]
    Other proteins in same PDB: d1ghqb1, d1ghqb2, d1ghqc1, d1ghqc2
    complexed with ndg, zn

Details for d1ghqa_

PDB Entry: 1ghq (more details), 2.04 Å

PDB Description: cr2-c3d complex structure
PDB Compounds: (A:) Complement C3

SCOPe Domain Sequences for d1ghqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ghqa_ a.102.4.4 (A:) Thio-ester containing domain (TED) from Complement C3, aka C3d or C3dg {Human (Homo sapiens) [TaxId: 9606]}
mldaerlkhlivtpsgageqnmigmtptviavhyldeteqwekfglekrqgalelikkgy
tqqlafrqpssafaafvkrapstwltayvvkvfslavnliaidsqvlcgavkwlilekqk
pdgvfqedapvihqemigglrnnnekdmaltafvlislqeakdiceeqvnslpgsitkag
dfleanymnlqrsytvaiagyalaqmgrlkgpllnkflttakdknrwedpgkqlynveat
syallallqlkdfdfvppvvrwlneqryygggygstqatfmvfqalaqyqkdapsdhqel
nldvslq

SCOPe Domain Coordinates for d1ghqa_:

Click to download the PDB-style file with coordinates for d1ghqa_.
(The format of our PDB-style files is described here.)

Timeline for d1ghqa_: