Class a: All alpha proteins [46456] (285 folds) |
Fold a.102: alpha/alpha toroid [48207] (6 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) |
Family a.102.4.4: Complement components [48251] (4 proteins) probably related to other families, but has no known enzymatic activity |
Protein Thio-ester containing domain (TED) from Complement C3, aka C3d or C3dg [48252] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [48253] (15 PDB entries) |
Domain d1ghqa_: 1ghq A: [60521] Other proteins in same PDB: d1ghqb1, d1ghqb2, d1ghqc1, d1ghqc2 complexed with ndg, zn |
PDB Entry: 1ghq (more details), 2.04 Å
SCOPe Domain Sequences for d1ghqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ghqa_ a.102.4.4 (A:) Thio-ester containing domain (TED) from Complement C3, aka C3d or C3dg {Human (Homo sapiens) [TaxId: 9606]} mldaerlkhlivtpsgageqnmigmtptviavhyldeteqwekfglekrqgalelikkgy tqqlafrqpssafaafvkrapstwltayvvkvfslavnliaidsqvlcgavkwlilekqk pdgvfqedapvihqemigglrnnnekdmaltafvlislqeakdiceeqvnslpgsitkag dfleanymnlqrsytvaiagyalaqmgrlkgpllnkflttakdknrwedpgkqlynveat syallallqlkdfdfvppvvrwlneqryygggygstqatfmvfqalaqyqkdapsdhqel nldvslq
Timeline for d1ghqa_:
View in 3D Domains from other chains: (mouse over for more information) d1ghqb1, d1ghqb2, d1ghqc1, d1ghqc2 |