Lineage for d1ghpa_ (1ghp A:)
- Root: SCOP 1.57
Class e: Multi-domain proteins (alpha and beta) [56572] (32 folds) Fold e.3: beta-Lactamase/D-ala carboxypeptidase [56600] (1 superfamily) Superfamily e.3.1: beta-Lactamase/D-ala carboxypeptidase [56601] (1 family) 
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (6 proteins) 
Protein beta-Lactamase, class A [56606] (12 species) 
Species Staphylococcus aureus [TaxId:1280] [56611] (16 PDB entries) 
Domain d1ghpa_: 1ghp A: [60520]
Details for d1ghpa_
PDB Entry: 1ghp (more details), 1.76 Å
PDB Description: structures of the acyl-enzyme complex of the staphylococcus aureus beta-lactamase mutant glu166asp:asn170gln with degraded benzylpenicillin
SCOP Domain Sequences for d1ghpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ghpa_ e.3.1.1 (A:) beta-Lactamase, class A {Staphylococcus aureus}
kelndlekkynahigvyaldtksgkevkfnsdkrfayastskainsailleqvpynklnk
kvhinkddivayspilekyvgkditlkalieasmtysdntannkiikeiggikkvkqrlk
elgdkvtnpvrydielqyyspkskkdtstpaafgktlnkliangklskenkkflldlmln
nksgdtlikdgvpkdykvadksgqaityasrndvafvypkgqsepivlviftnkdnksdk
pndklisetaksvmkef
SCOP Domain Coordinates for d1ghpa_:
Click to download the PDB-style file with coordinates for d1ghpa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ghpa_:
- d1ghpa_ is new in SCOP 1.57
- d1ghpa_ appears in SCOP 1.59
- d1ghpa_ appears in the current release, SCOPe 2.08
View in 3D