Lineage for d1ghpa_ (1ghp A:)

  1. Root: SCOP 1.57
  2. 86313Class e: Multi-domain proteins (alpha and beta) [56572] (32 folds)
  3. 86412Fold e.3: beta-Lactamase/D-ala carboxypeptidase [56600] (1 superfamily)
  4. 86413Superfamily e.3.1: beta-Lactamase/D-ala carboxypeptidase [56601] (1 family) (S)
  5. 86414Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (6 proteins)
  6. 86453Protein beta-Lactamase, class A [56606] (12 species)
  7. 86498Species Staphylococcus aureus [TaxId:1280] [56611] (16 PDB entries)
  8. 86499Domain d1ghpa_: 1ghp A: [60520]

Details for d1ghpa_

PDB Entry: 1ghp (more details), 1.76 Å

PDB Description: structures of the acyl-enzyme complex of the staphylococcus aureus beta-lactamase mutant glu166asp:asn170gln with degraded benzylpenicillin

SCOP Domain Sequences for d1ghpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ghpa_ e.3.1.1 (A:) beta-Lactamase, class A {Staphylococcus aureus}
kelndlekkynahigvyaldtksgkevkfnsdkrfayastskainsailleqvpynklnk
kvhinkddivayspilekyvgkditlkalieasmtysdntannkiikeiggikkvkqrlk
elgdkvtnpvrydielqyyspkskkdtstpaafgktlnkliangklskenkkflldlmln
nksgdtlikdgvpkdykvadksgqaityasrndvafvypkgqsepivlviftnkdnksdk
pndklisetaksvmkef

SCOP Domain Coordinates for d1ghpa_:

Click to download the PDB-style file with coordinates for d1ghpa_.
(The format of our PDB-style files is described here.)

Timeline for d1ghpa_: