![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
![]() | Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
![]() | Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) ![]() |
![]() | Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
![]() | Protein beta-Lactamase, class A [56606] (16 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [56611] (16 PDB entries) |
![]() | Domain d1ghpa_: 1ghp A: [60520] complexed with pnm, so4; mutant |
PDB Entry: 1ghp (more details), 1.76 Å
SCOPe Domain Sequences for d1ghpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ghpa_ e.3.1.1 (A:) beta-Lactamase, class A {Staphylococcus aureus [TaxId: 1280]} kelndlekkynahigvyaldtksgkevkfnsdkrfayastskainsailleqvpynklnk kvhinkddivayspilekyvgkditlkalieasmtysdntannkiikeiggikkvkqrlk elgdkvtnpvrydielqyyspkskkdtstpaafgktlnkliangklskenkkflldlmln nksgdtlikdgvpkdykvadksgqaityasrndvafvypkgqsepivlviftnkdnksdk pndklisetaksvmkef
Timeline for d1ghpa_: