Lineage for d1gh5a_ (1gh5 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2383151Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
    duplication: has internal pseudo twofold symmetry
  4. 2383152Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) (S)
  5. 2383298Family b.11.1.6: Antifungal protein AFP1 [63693] (1 protein)
    shares putative chitin-binding site with SKLP
  6. 2383299Protein Antifungal protein AFP1 [63694] (1 species)
  7. 2383300Species Streptomyces tendae, tu901 [TaxId:1932] [63695] (2 PDB entries)
  8. 2383301Domain d1gh5a_: 1gh5 A: [60517]
    CASP4

Details for d1gh5a_

PDB Entry: 1gh5 (more details)

PDB Description: antifungal protein from streptomyces tendae tu901, nmr average structure
PDB Compounds: (A:) antifungal protein

SCOPe Domain Sequences for d1gh5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gh5a_ b.11.1.6 (A:) Antifungal protein AFP1 {Streptomyces tendae, tu901 [TaxId: 1932]}
minrtdcnensyleihnnegrdtlcfanagtmpvaiygvnwvesgnnvvtlqfqrnlsdp
rletitlqkwgswnpghiheilsiriy

SCOPe Domain Coordinates for d1gh5a_:

Click to download the PDB-style file with coordinates for d1gh5a_.
(The format of our PDB-style files is described here.)

Timeline for d1gh5a_: