Lineage for d1gh0x_ (1gh0 X:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1473061Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1473062Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1475382Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 1475475Protein Phycocyanin beta subunit [88940] (8 species)
  7. 1475485Species Spirulina platensis [TaxId:118562] [88952] (2 PDB entries)
  8. 1475509Domain d1gh0x_: 1gh0 X: [60514]
    Other proteins in same PDB: d1gh0a_, d1gh0c_, d1gh0e_, d1gh0g_, d1gh0i_, d1gh0k_, d1gh0m_, d1gh0o_, d1gh0q_, d1gh0s_, d1gh0u_, d1gh0w_
    complexed with cyc

Details for d1gh0x_

PDB Entry: 1gh0 (more details), 2.2 Å

PDB Description: crystal structure of c-phycocyanin from spirulina platensis
PDB Compounds: (X:) c-phycocyanin beta subunit

SCOPe Domain Sequences for d1gh0x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gh0x_ a.1.1.3 (X:) Phycocyanin beta subunit {Spirulina platensis [TaxId: 118562]}
mfdaftkvvsqadtrgemlstaqidalsqmvaesnkrldvvnritsnastivsnaarslf
aeqpqliapggnaytsrrmaaclrdmeiilryvtyavfagdasvledrclnglretylal
gtpgssvavgvgkmkeaalaivndpagitpgdcsalaseiagyfdraaaavs

SCOPe Domain Coordinates for d1gh0x_:

Click to download the PDB-style file with coordinates for d1gh0x_.
(The format of our PDB-style files is described here.)

Timeline for d1gh0x_: