Class a: All alpha proteins [46456] (286 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins) oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus binds a bilin chromophore automatically mapped to Pfam PF00502 |
Protein Phycocyanin alpha subunit [88933] (9 species) |
Species Spirulina platensis [TaxId:118562] [88939] (2 PDB entries) |
Domain d1gh0e_: 1gh0 E: [60495] Other proteins in same PDB: d1gh0b_, d1gh0d_, d1gh0f_, d1gh0h_, d1gh0j_, d1gh0l_, d1gh0n_, d1gh0p_, d1gh0r_, d1gh0t_, d1gh0v_, d1gh0x_ complexed with cyc |
PDB Entry: 1gh0 (more details), 2.2 Å
SCOPe Domain Sequences for d1gh0e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gh0e_ a.1.1.3 (E:) Phycocyanin alpha subunit {Spirulina platensis [TaxId: 118562]} mktplteavsvadsqgrflssteiqvafgrfrqakagleaakaltskadslisgaaqavy nkfpyttqmqgpnyaadqrgkdkcardigyylrmvtycliaggtgpmdeyliagideinr tfelspswyiealkyikanhglsgdaaveansyldyainals
Timeline for d1gh0e_: