Lineage for d1gh0b_ (1gh0 B:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 275721Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 275722Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 276690Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (6 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
  6. 276756Protein Phycocyanin beta subunit [88940] (6 species)
  7. 276766Species Spirulina platensis [TaxId:118562] [88952] (2 PDB entries)
  8. 276767Domain d1gh0b_: 1gh0 B: [60492]
    Other proteins in same PDB: d1gh0a_, d1gh0c_, d1gh0e_, d1gh0g_, d1gh0i_, d1gh0k_, d1gh0m_, d1gh0o_, d1gh0q_, d1gh0s_, d1gh0u_, d1gh0w_

Details for d1gh0b_

PDB Entry: 1gh0 (more details), 2.2 Å

PDB Description: crystal structure of c-phycocyanin from spirulina platensis

SCOP Domain Sequences for d1gh0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gh0b_ a.1.1.3 (B:) Phycocyanin beta subunit {Spirulina platensis}
mfdaftkvvsqadtrgemlstaqidalsqmvaesnkrldvvnritsnastivsnaarslf
aeqpqliapggnaytsrrmaaclrdmeiilryvtyavfagdasvledrclnglretylal
gtpgssvavgvgkmkeaalaivndpagitpgdcsalaseiagyfdraaaavs

SCOP Domain Coordinates for d1gh0b_:

Click to download the PDB-style file with coordinates for d1gh0b_.
(The format of our PDB-style files is described here.)

Timeline for d1gh0b_: