Lineage for d1ggwa_ (1ggw A:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 47511Fold a.39: EF Hand-like [47472] (3 superfamilies)
  4. 47512Superfamily a.39.1: EF-hand [47473] (8 families) (S)
  5. 47621Family a.39.1.5: Calmodulin-like [47502] (15 proteins)
  6. 47696Protein Cdc4p [63543] (1 species)
  7. 47697Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [63544] (1 PDB entry)
  8. 47698Domain d1ggwa_: 1ggw A: [60490]

Details for d1ggwa_

PDB Entry: 1ggw (more details)

PDB Description: cdc4p from schizosaccharomyces pombe

SCOP Domain Sequences for d1ggwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe)}
stddspykqafslfdrhgtgripktsigdllracgqnptlaeiteiestlpaevdmeqfl
qvlnrpngfdmpgdpeefvkgfqvfdkdatgmigvgelryvltslgeklsneemdellkg
vpvkdgmvnyhdfvqmilan

SCOP Domain Coordinates for d1ggwa_:

Click to download the PDB-style file with coordinates for d1ggwa_.
(The format of our PDB-style files is described here.)

Timeline for d1ggwa_: