Lineage for d1ggqd_ (1ggq D:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1083284Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1083760Superfamily a.24.12: Outer surface protein C (OspC) [63515] (2 families) (S)
  5. 1083761Family a.24.12.1: Outer surface protein C (OspC) [63516] (1 protein)
  6. 1083762Protein Outer surface protein C (OspC) [63517] (1 species)
  7. 1083763Species Lyme disease spirochete (Borrelia burgdorferi), different strains [TaxId:139] [63518] (3 PDB entries)
  8. 1083772Domain d1ggqd_: 1ggq D: [60489]
    complexed with mg

Details for d1ggqd_

PDB Entry: 1ggq (more details), 2.51 Å

PDB Description: outer surface protein c (ospc) of borrelia burgdorferi strain b31
PDB Compounds: (D:) outer surface protein c

SCOPe Domain Sequences for d1ggqd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ggqd_ a.24.12.1 (D:) Outer surface protein C (OspC) {Lyme disease spirochete (Borrelia burgdorferi), different strains [TaxId: 139]}
pnlteiskkitdsnavllavkeveallssideiaakaigkkihqnngldtennhngslla
gayaistlikqkldglkneglkekidaakkcsetftnklkekhtdlgkegvtdadakeai
lktngtktkgaeelgklfesvevlskaakemlansvkeltsp

SCOPe Domain Coordinates for d1ggqd_:

Click to download the PDB-style file with coordinates for d1ggqd_.
(The format of our PDB-style files is described here.)

Timeline for d1ggqd_: