SCOPe 2.01: Domain d1ggqd_: 1ggq D:

Lineage for d1ggqd_ (1ggq D:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.12: Outer surface protein C (OspC) [63515] (2 families)

5. Family a.24.12.1: Outer surface protein C (OspC) [63516] (1 protein)

6. Protein Outer surface protein C (OspC) [63517] (1 species)

7. Species Lyme disease spirochete (Borrelia burgdorferi), different strains [TaxId:139] [63518] (3 PDB entries)

8. Domain d1ggqd_: 1ggq D: [60489]
   complexed with mg

Details for d1ggqd_

PDB Entry: 1ggq, 2.51 Å

PDB Description: outer surface protein c (ospc) of borrelia burgdorferi strain b31

PDB Compounds: (D:) outer surface protein c

SCOPe Domain Sequences for d1ggqd_:

Sequence; same for both SEQRES and ATOM records:

>d1ggqd_ a.24.12.1 (D:) Outer surface protein C (OspC) {Lyme disease spirochete (Borrelia burgdorferi), different strains [TaxId: 139]}
pnlteiskkitdsnavllavkeveallssideiaakaigkkihqnngldtennhngslla
gayaistlikqkldglkneglkekidaakkcsetftnklkekhtdlgkegvtdadakeai
lktngtktkgaeelgklfesvevlskaakemlansvkeltsp

Timeline for d1ggqd_:

• d1ggqd_ first appeared in SCOP 1.57
  
• d1ggqd_ appears in SCOP 1.75
  
• d1ggqd_ appears in SCOPe 2.02
  
• d1ggqd_ appears in the current release, SCOPe 2.08