Lineage for d1geya_ (1gey A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2130992Family c.67.1.1: AAT-like [53384] (17 protein domains)
  6. 2131239Protein Histidinol-phosphate aminotransferase HisC [64121] (2 species)
  7. 2131240Species Escherichia coli [TaxId:562] [64122] (6 PDB entries)
  8. 2131246Domain d1geya_: 1gey A: [60472]
    complexed with ppe

Details for d1geya_

PDB Entry: 1gey (more details), 2.3 Å

PDB Description: crystal structure of histidinol-phosphate aminotransferase complexed with n-(5'-phosphopyridoxyl)-l-glutamate
PDB Compounds: (A:) Histidinol-phosphate aminotransferase

SCOPe Domain Sequences for d1geya_:

Sequence, based on SEQRES records: (download)

>d1geya_ c.67.1.1 (A:) Histidinol-phosphate aminotransferase HisC {Escherichia coli [TaxId: 562]}
titdlarenvrnltpyqsarrlggngdvwlnaneyptavefqltqqtlnrypecqpkavi
enyaqyagvkpeqvlvsrgadegiellirafcepgkdailycpptygmysvsaetigvec
rtvptldnwqldlqgisdkldgvkvvyvcspnnptgqlinpqdfrtlleltrgkaivvad
eayiefcpqaslagwlaeyphlailrtlskafalaglrcgftlaneevinllmkviapyp
lstpvadiaaqalspqgivamrervaqiiaereyliaalkeipcveqvfdsetnyilarf
kassavfkslwdqgiilrdqnkqpslsgclritvgtreesqrvidal

Sequence, based on observed residues (ATOM records): (download)

>d1geya_ c.67.1.1 (A:) Histidinol-phosphate aminotransferase HisC {Escherichia coli [TaxId: 562]}
titdlarenvrnlarvwlnaneyptavefqltqqtlnrypecqpkavienyaqyagvkpe
qvlvsrgadegiellirafcepgkdailycpptygmysvsaetigvecrtvptldnwqld
lqgisdkldgvkvvyvcspnnptgqlinpqdfrtlleltrgkaivvadeayiefcpqasl
agwlaeyphlailrtlskafalaglrcgftlaneevinllmkviapyplstpvadiaaqa
lspqgivamrervaqiiaereyliaalkeipcveqvfdsetnyilarfkassavfkslwd
qgiilrdqnkqpslsgclritvgtreesqrvidal

SCOPe Domain Coordinates for d1geya_:

Click to download the PDB-style file with coordinates for d1geya_.
(The format of our PDB-style files is described here.)

Timeline for d1geya_: