Lineage for d1gewa_ (1gew A:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 73100Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
  4. 73101Superfamily c.67.1: PLP-dependent transferases [53383] (5 families) (S)
  5. 73102Family c.67.1.1: AAT-like [53384] (5 proteins)
  6. 73267Protein Histidinol-phosphate aminotransferase [64121] (1 species)
  7. 73268Species Escherichia coli [TaxId:562] [64122] (6 PDB entries)
  8. 73270Domain d1gewa_: 1gew A: [60470]

Details for d1gewa_

PDB Entry: 1gew (more details), 2 Å

PDB Description: crystal structure of histidinol-phosphate aminotransferase complexed with pyridoxal 5'-phosphate

SCOP Domain Sequences for d1gewa_:

Sequence, based on SEQRES records: (download)

>d1gewa_ c.67.1.1 (A:) Histidinol-phosphate aminotransferase {Escherichia coli}
titdlarenvrnltpyqsarrlggngdvwlnaneyptavefqltqqtlnrypecqpkavi
enyaqyagvkpeqvlvsrgadegiellirafcepgkdailycpptygmysvsaetigvec
rtvptldnwqldlqgisdkldgvkvvyvcspnnptgqlinpqdfrtlleltrgkaivvad
eayiefcpqaslagwlaeyphlailrtlskafalaglrcgftlaneevinllmkviapyp
lstpvadiaaqalspqgivamrervaqiiaereyliaalkeipcveqvfdsetnyilarf
kassavfkslwdqgiilrdqnkqpslsgclritvgtreesqrvidal

Sequence, based on observed residues (ATOM records): (download)

>d1gewa_ c.67.1.1 (A:) Histidinol-phosphate aminotransferase {Escherichia coli}
titdlarenvrnlvwlnaneyptavefqltqqtlnrypecqpkavienyaqyagvkpeqv
lvsrgadegiellirafcepgkdailycpptygmysvsaetigvecrtvptldnwqldlq
gisdkldgvkvvyvcspnnptgqlinpqdfrtlleltrgkaivvadeayiefcpqaslag
wlaeyphlailrtlskafalaglrcgftlaneevinllmkviapyplstpvadiaaqals
pqgivamrervaqiiaereyliaalkeipcveqvfdsetnyilarfkassavfkslwdqg
iilrdqnkqpslsgclritvgtreesqrvidal

SCOP Domain Coordinates for d1gewa_:

Click to download the PDB-style file with coordinates for d1gewa_.
(The format of our PDB-style files is described here.)

Timeline for d1gewa_: