Lineage for d1gefe_ (1gef E:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1371642Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 1371643Superfamily c.52.1: Restriction endonuclease-like [52980] (34 families) (S)
  5. 1371870Family c.52.1.18: Hjc-like [64080] (3 proteins)
    Pfam PF01870
  6. 1371871Protein Archaeal Holliday junction resolvase Hjc [64081] (2 species)
  7. 1371872Species Pyrococcus furiosus [TaxId:2261] [64082] (2 PDB entries)
  8. 1371876Domain d1gefe_: 1gef E: [60468]
    complexed with so4

Details for d1gefe_

PDB Entry: 1gef (more details), 2 Å

PDB Description: Crystal structure of the archaeal holliday junction resolvase HJC
PDB Compounds: (E:) holliday junction resolvase

SCOPe Domain Sequences for d1gefe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gefe_ c.52.1.18 (E:) Archaeal Holliday junction resolvase Hjc {Pyrococcus furiosus [TaxId: 2261]}
myrkgaqaerelikllekhgfavvrsagskkvdlvagngkkylcievkvtkkdhlyvgkr
dmgrliefsrrfggipvlavkflnvgwrfievspkiekfvftpssgvslevllg

SCOPe Domain Coordinates for d1gefe_:

Click to download the PDB-style file with coordinates for d1gefe_.
(The format of our PDB-style files is described here.)

Timeline for d1gefe_: