SCOPe 2.02: Domain d1gefe_: 1gef E:

Lineage for d1gefe_ (1gef E:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (34 families)

5. Family c.52.1.18: Hjc-like [64080] (3 proteins)
   Pfam PF01870

6. Protein Archaeal Holliday junction resolvase Hjc [64081] (2 species)

7. Species Pyrococcus furiosus [TaxId:2261] [64082] (2 PDB entries)

8. Domain d1gefe_: 1gef E: [60468]
   complexed with so4

Details for d1gefe_

PDB Entry: 1gef, 2 Å

PDB Description: Crystal structure of the archaeal holliday junction resolvase HJC

PDB Compounds: (E:) holliday junction resolvase

SCOPe Domain Sequences for d1gefe_:

Sequence; same for both SEQRES and ATOM records:

>d1gefe_ c.52.1.18 (E:) Archaeal Holliday junction resolvase Hjc {Pyrococcus furiosus [TaxId: 2261]}
myrkgaqaerelikllekhgfavvrsagskkvdlvagngkkylcievkvtkkdhlyvgkr
dmgrliefsrrfggipvlavkflnvgwrfievspkiekfvftpssgvslevllg

Timeline for d1gefe_:

• d1gefe_ first appeared in SCOP 1.57
  
• d1gefe_ appears in SCOPe 2.01
  
• d1gefe_ appears in SCOPe 2.03
  
• d1gefe_ appears in the current release, SCOPe 2.08