Lineage for d1gefd_ (1gef D:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1170597Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 1170598Superfamily c.52.1: Restriction endonuclease-like [52980] (34 families) (S)
  5. 1170812Family c.52.1.18: Hjc-like [64080] (3 proteins)
    Pfam PF01870
  6. 1170813Protein Archaeal Holliday junction resolvase Hjc [64081] (2 species)
  7. 1170814Species Pyrococcus furiosus [TaxId:2261] [64082] (2 PDB entries)
  8. 1170817Domain d1gefd_: 1gef D: [60467]
    complexed with so4

Details for d1gefd_

PDB Entry: 1gef (more details), 2 Å

PDB Description: Crystal structure of the archaeal holliday junction resolvase HJC
PDB Compounds: (D:) holliday junction resolvase

SCOPe Domain Sequences for d1gefd_:

Sequence, based on SEQRES records: (download)

>d1gefd_ c.52.1.18 (D:) Archaeal Holliday junction resolvase Hjc {Pyrococcus furiosus [TaxId: 2261]}
myrkgaqaerelikllekhgfavvrsagskkvdlvagngkkylcievkvtkkdhlyvgkr
dmgrliefsrrfggipvlavkflnvgwrfievspkiekfvftpssgvslevllgiq

Sequence, based on observed residues (ATOM records): (download)

>d1gefd_ c.52.1.18 (D:) Archaeal Holliday junction resolvase Hjc {Pyrococcus furiosus [TaxId: 2261]}
myrkgaqaerelikllekhgfavvrsagskkvdlvagngkkylcievkvtkkdhlyvgkr
dmgrliefsrrfggipvlavkfwrfievspkfvftpssgvslevllgiq

SCOPe Domain Coordinates for d1gefd_:

Click to download the PDB-style file with coordinates for d1gefd_.
(The format of our PDB-style files is described here.)

Timeline for d1gefd_: