Lineage for d1gefb_ (1gef B:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 316351Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 316352Superfamily c.52.1: Restriction endonuclease-like [52980] (20 families) (S)
  5. 316535Family c.52.1.18: Archaeal Holliday junction resolvase Hjc [64080] (1 protein)
  6. 316536Protein Archaeal Holliday junction resolvase Hjc [64081] (2 species)
  7. 316537Species Archaeon Pyrococcus furiosus [TaxId:2261] [64082] (2 PDB entries)
  8. 316539Domain d1gefb_: 1gef B: [60466]

Details for d1gefb_

PDB Entry: 1gef (more details), 2 Å

PDB Description: Crystal structure of the archaeal holliday junction resolvase HJC

SCOP Domain Sequences for d1gefb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gefb_ c.52.1.18 (B:) Archaeal Holliday junction resolvase Hjc {Archaeon Pyrococcus furiosus}
myrkgaqaerelikllekhgfavvrsagskkvdlvagngkkylcievkvtkkdhlyvgkr
dmgrliefsrrfggipvlavkflnvgwrfievspkiekfvftpssgvslevllgiq

SCOP Domain Coordinates for d1gefb_:

Click to download the PDB-style file with coordinates for d1gefb_.
(The format of our PDB-style files is described here.)

Timeline for d1gefb_: