Lineage for d1ge7b_ (1ge7 B:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 135687Fold d.92: Zincin-like [55485] (2 superfamilies)
  4. 135688Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) (S)
  5. 135937Family d.92.1.12: Fungal zinc peptidase [64335] (1 protein)
  6. 135938Protein Fungal zinc peptidase [64336] (2 species)
  7. 135941Species Grifola frondosa [64337] (4 PDB entries)
  8. 135944Domain d1ge7b_: 1ge7 B: [60462]

Details for d1ge7b_

PDB Entry: 1ge7 (more details), 2 Å

PDB Description: zinc peptidase from grifola frondosa

SCOP Domain Sequences for d1ge7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ge7b_ d.92.1.12 (B:) Fungal zinc peptidase {Grifola frondosa}
tyngcssseqsalaaaasaaqsyvaeslsylqthtaatpryttwfgsyissrhstvlqhy
tdmnsndfssysfdctctaagtfayvypnrfgtvylcgafwkapttgtdsqagtlvhess
hftrnggtkdyaygqaaakslatmdpdkavmnadnheyfsennpaqs

SCOP Domain Coordinates for d1ge7b_:

Click to download the PDB-style file with coordinates for d1ge7b_.
(The format of our PDB-style files is described here.)

Timeline for d1ge7b_: