SCOPe 2.05: Domain d1ge7a_: 1ge7 A:

Lineage for d1ge7a_ (1ge7 A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.12: Fungal zinc peptidase [64335] (1 protein)
   single domain with insertions in the common fold

6. Protein Fungal zinc peptidase [64336] (2 species)

7. Species Grifola frondosa [TaxId:5627] [64337] (4 PDB entries)

8. Domain d1ge7a_: 1ge7 A: [60461]
   complexed with man, zn

Details for d1ge7a_

PDB Entry: 1ge7, 2 Å

PDB Description: zinc peptidase from grifola frondosa

PDB Compounds: (A:) peptidyl-lys metalloendopeptidase

SCOPe Domain Sequences for d1ge7a_:

Sequence; same for both SEQRES and ATOM records:

>d1ge7a_ d.92.1.12 (A:) Fungal zinc peptidase {Grifola frondosa [TaxId: 5627]}
tyngcssseqsalaaaasaaqsyvaeslsylqthtaatpryttwfgsyissrhstvlqhy
tdmnsndfssysfdctctaagtfayvypnrfgtvylcgafwkapttgtdsqagtlvhess
hftrnggtkdyaygqaaakslatmdpdkavmnadnheyfsennpaqs

Timeline for d1ge7a_:

• d1ge7a_ first appeared in SCOP 1.57
  
• d1ge7a_ appears in SCOPe 2.04
  
• d1ge7a_ appears in SCOPe 2.06
  
• d1ge7a_ appears in the current release, SCOPe 2.08