Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (17 families) |
Family d.92.1.12: Fungal zinc peptidase [64335] (1 protein) single domain with insertions in the common fold |
Protein Fungal zinc peptidase [64336] (2 species) |
Species Grifola frondosa [TaxId:5627] [64337] (4 PDB entries) |
Domain d1ge7a_: 1ge7 A: [60461] |
PDB Entry: 1ge7 (more details), 2 Å
SCOP Domain Sequences for d1ge7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ge7a_ d.92.1.12 (A:) Fungal zinc peptidase {Grifola frondosa [TaxId: 5627]} tyngcssseqsalaaaasaaqsyvaeslsylqthtaatpryttwfgsyissrhstvlqhy tdmnsndfssysfdctctaagtfayvypnrfgtvylcgafwkapttgtdsqagtlvhess hftrnggtkdyaygqaaakslatmdpdkavmnadnheyfsennpaqs
Timeline for d1ge7a_: