Lineage for d1gdeb_ (1gde B:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 840449Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 840450Superfamily c.67.1: PLP-dependent transferases [53383] (9 families) (S)
  5. 840451Family c.67.1.1: AAT-like [53384] (16 proteins)
  6. 840469Protein Aromatic aminoacid aminotransferase, AroAT [53392] (3 species)
  7. 840470Species Archaeon Pyrococcus horikoshii [TaxId:53953] [64120] (3 PDB entries)
  8. 840472Domain d1gdeb_: 1gde B: [60457]
    complexed with glu, plp

Details for d1gdeb_

PDB Entry: 1gde (more details), 1.8 Å

PDB Description: crystal structure of pyrococcus protein a-1 e-form
PDB Compounds: (B:) aspartate aminotransferase

SCOP Domain Sequences for d1gdeb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gdeb_ c.67.1.1 (B:) Aromatic aminoacid aminotransferase, AroAT {Archaeon Pyrococcus horikoshii [TaxId: 53953]}
alsdrlelvsaseirklfdiaagmkdvislgigepdfdtpqhikeyakealdkglthygp
nigllelreaiaeklkkqngieadpkteimvllganqaflmglsaflkdgeevliptpaf
vsyapavilaggkpvevptyeedefrlnvdelkkyvtdktraliinspcnptgavltkkd
leeiadfvvehdlivisdevyehfiyddarhysiasldgmfertitvngfsktfamtgwr
lgfvaapswiiermvkfqmynatcpvtfiqyaaakalkderswkaveemrkeydrrrklv
wkrlnemglptvkpkgafyifprirdtgltskkfselmlkearvavvpgsafgkagegyv
risyatayekleeamdrmervlkerklv

SCOP Domain Coordinates for d1gdeb_:

Click to download the PDB-style file with coordinates for d1gdeb_.
(The format of our PDB-style files is described here.)

Timeline for d1gdeb_: