Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.1: AAT-like [53384] (17 proteins) |
Protein Aromatic aminoacid aminotransferase, AroAT [53392] (4 species) |
Species Pyrococcus horikoshii [TaxId:53953] [64120] (3 PDB entries) |
Domain d1gd9a_: 1gd9 A: [60454] complexed with plp |
PDB Entry: 1gd9 (more details), 1.8 Å
SCOPe Domain Sequences for d1gd9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gd9a_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Pyrococcus horikoshii [TaxId: 53953]} alsdrlelvsaseirklfdiaagmkdvislgigepdfdtpqhikeyakealdkglthygp nigllelreaiaeklkkqngieadpkteimvllganqaflmglsaflkdgeevliptpaf vsyapavilaggkpvevptyeedefrlnvdelkkyvtdktraliinspcnptgavltkkd leeiadfvvehdlivisdevyehfiyddarhysiasldgmfertitvngfsktfamtgwr lgfvaapswiiermvkfqmynatcpvtfiqyaaakalkderswkaveemrkeydrrrklv wkrlnemglptvkpkgafyifprirdtgltskkfselmlkearvavvpgsafgkagegyv risyatayekleeamdrmervlkerklv
Timeline for d1gd9a_: