Lineage for d1gd9a_ (1gd9 A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 705327Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 705328Superfamily c.67.1: PLP-dependent transferases [53383] (8 families) (S)
  5. 705329Family c.67.1.1: AAT-like [53384] (16 proteins)
  6. 705347Protein Aromatic aminoacid aminotransferase, AroAT [53392] (3 species)
  7. 705348Species Archaeon Pyrococcus horikoshii [TaxId:53953] [64120] (3 PDB entries)
  8. 705351Domain d1gd9a_: 1gd9 A: [60454]

Details for d1gd9a_

PDB Entry: 1gd9 (more details), 1.8 Å

PDB Description: crystall structure of pyrococcus protein-a1
PDB Compounds: (A:) aspartate aminotransferase

SCOP Domain Sequences for d1gd9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gd9a_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Archaeon Pyrococcus horikoshii [TaxId: 53953]}
alsdrlelvsaseirklfdiaagmkdvislgigepdfdtpqhikeyakealdkglthygp
nigllelreaiaeklkkqngieadpkteimvllganqaflmglsaflkdgeevliptpaf
vsyapavilaggkpvevptyeedefrlnvdelkkyvtdktraliinspcnptgavltkkd
leeiadfvvehdlivisdevyehfiyddarhysiasldgmfertitvngfsktfamtgwr
lgfvaapswiiermvkfqmynatcpvtfiqyaaakalkderswkaveemrkeydrrrklv
wkrlnemglptvkpkgafyifprirdtgltskkfselmlkearvavvpgsafgkagegyv
risyatayekleeamdrmervlkerklv

SCOP Domain Coordinates for d1gd9a_:

Click to download the PDB-style file with coordinates for d1gd9a_.
(The format of our PDB-style files is described here.)

Timeline for d1gd9a_: