Lineage for d1gd9a_ (1gd9 A:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 73100Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
  4. 73101Superfamily c.67.1: PLP-dependent transferases [53383] (5 families) (S)
  5. 73102Family c.67.1.1: AAT-like [53384] (5 proteins)
  6. 73103Protein Aromatic aminoacid aminotransferase, AroAT [53392] (3 species)
  7. 73104Species Archaeon Pyrococcus horikoshii [TaxId:53953] [64120] (3 PDB entries)
  8. 73107Domain d1gd9a_: 1gd9 A: [60454]

Details for d1gd9a_

PDB Entry: 1gd9 (more details), 1.8 Å

PDB Description: crystall structure of pyrococcus protein-a1

SCOP Domain Sequences for d1gd9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gd9a_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Archaeon Pyrococcus horikoshii}
alsdrlelvsaseirklfdiaagmkdvislgigepdfdtpqhikeyakealdkglthygp
nigllelreaiaeklkkqngieadpkteimvllganqaflmglsaflkdgeevliptpaf
vsyapavilaggkpvevptyeedefrlnvdelkkyvtdktraliinspcnptgavltkkd
leeiadfvvehdlivisdevyehfiyddarhysiasldgmfertitvngfsktfamtgwr
lgfvaapswiiermvkfqmynatcpvtfiqyaaakalkderswkaveemrkeydrrrklv
wkrlnemglptvkpkgafyifprirdtgltskkfselmlkearvavvpgsafgkagegyv
risyatayekleeamdrmervlkerklv

SCOP Domain Coordinates for d1gd9a_:

Click to download the PDB-style file with coordinates for d1gd9a_.
(The format of our PDB-style files is described here.)

Timeline for d1gd9a_: