Lineage for d1gd9a_ (1gd9 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2895168Family c.67.1.1: AAT-like [53384] (17 proteins)
  6. 2895181Protein Aromatic aminoacid aminotransferase, AroAT [53392] (4 species)
  7. 2895221Species Pyrococcus horikoshii [TaxId:53953] [64120] (3 PDB entries)
  8. 2895224Domain d1gd9a_: 1gd9 A: [60454]
    complexed with plp

Details for d1gd9a_

PDB Entry: 1gd9 (more details), 1.8 Å

PDB Description: crystall structure of pyrococcus protein-a1
PDB Compounds: (A:) aspartate aminotransferase

SCOPe Domain Sequences for d1gd9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gd9a_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Pyrococcus horikoshii [TaxId: 53953]}
alsdrlelvsaseirklfdiaagmkdvislgigepdfdtpqhikeyakealdkglthygp
nigllelreaiaeklkkqngieadpkteimvllganqaflmglsaflkdgeevliptpaf
vsyapavilaggkpvevptyeedefrlnvdelkkyvtdktraliinspcnptgavltkkd
leeiadfvvehdlivisdevyehfiyddarhysiasldgmfertitvngfsktfamtgwr
lgfvaapswiiermvkfqmynatcpvtfiqyaaakalkderswkaveemrkeydrrrklv
wkrlnemglptvkpkgafyifprirdtgltskkfselmlkearvavvpgsafgkagegyv
risyatayekleeamdrmervlkerklv

SCOPe Domain Coordinates for d1gd9a_:

Click to download the PDB-style file with coordinates for d1gd9a_.
(The format of our PDB-style files is described here.)

Timeline for d1gd9a_: