Lineage for d1gd8i_ (1gd8 I:)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.188: Prokaryotic ribosomal protein L17 [64262] (1 superfamily) Superfamily d.188.1: Prokaryotic ribosomal protein L17 [64263] (1 family) 
Family d.188.1.1: Prokaryotic ribosomal protein L17 [64264] (1 protein) Protein Prokaryotic ribosomal protein L17 [64265] (1 species) Species Thermus thermophilus [TaxId:274] [64266] (1 PDB entry) 
Domain d1gd8i_: 1gd8 I: [60453]
Details for d1gd8i_
PDB Entry: 1gd8 (more details), 2.3 Å
PDB Description: the crystal structure of bacteria-specific l17 ribosomal protein.
SCOP Domain Sequences for d1gd8i_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gd8i_ d.188.1.1 (I:) Prokaryotic ribosomal protein L17 {Thermus thermophilus}
sshrlalyrnqaksllthgritttvpkakelrgfvdhlihlakrgdlharrlvlrdlqdv
klvrklfdeiapryrdrqggytrvlklaerrrgdgaplalvelve
SCOP Domain Coordinates for d1gd8i_:
Click to download the PDB-style file with coordinates for d1gd8i_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gd8i_:
- d1gd8i_ first appeared in SCOP 1.57
- d1gd8i_ appears in SCOP 1.59
- d1gd8i_ appears in SCOP 1.63
- d1gd8i_ appears in the current release, SCOPe 2.08
View in 3D
