Lineage for d1gd8i_ (1gd8 I:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 140139Fold d.188: Prokaryotic ribosomal protein L17 [64262] (1 superfamily)
  4. 140140Superfamily d.188.1: Prokaryotic ribosomal protein L17 [64263] (1 family) (S)
  5. 140141Family d.188.1.1: Prokaryotic ribosomal protein L17 [64264] (1 protein)
  6. 140142Protein Prokaryotic ribosomal protein L17 [64265] (1 species)
  7. 140143Species Thermus thermophilus [TaxId:274] [64266] (1 PDB entry)
  8. 140152Domain d1gd8i_: 1gd8 I: [60453]

Details for d1gd8i_

PDB Entry: 1gd8 (more details), 2.3 Å

PDB Description: the crystal structure of bacteria-specific l17 ribosomal protein.

SCOP Domain Sequences for d1gd8i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gd8i_ d.188.1.1 (I:) Prokaryotic ribosomal protein L17 {Thermus thermophilus}
sshrlalyrnqaksllthgritttvpkakelrgfvdhlihlakrgdlharrlvlrdlqdv
klvrklfdeiapryrdrqggytrvlklaerrrgdgaplalvelve

SCOP Domain Coordinates for d1gd8i_:

Click to download the PDB-style file with coordinates for d1gd8i_.
(The format of our PDB-style files is described here.)

Timeline for d1gd8i_: