Lineage for d1gd8d_ (1gd8 D:)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.188: Prokaryotic ribosomal protein L17 [64262] (1 superfamily) Superfamily d.188.1: Prokaryotic ribosomal protein L17 [64263] (1 family) 
Family d.188.1.1: Prokaryotic ribosomal protein L17 [64264] (1 protein) Protein Prokaryotic ribosomal protein L17 [64265] (1 species) Species Thermus thermophilus [TaxId:274] [64266] (1 PDB entry) 
Domain d1gd8d_: 1gd8 D: [60448]
Details for d1gd8d_
PDB Entry: 1gd8 (more details), 2.3 Å
PDB Description: the crystal structure of bacteria-specific l17 ribosomal protein.
SCOP Domain Sequences for d1gd8d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gd8d_ d.188.1.1 (D:) Prokaryotic ribosomal protein L17 {Thermus thermophilus}
sshrlalyrnqaksllthgritttvpkakelrgfvdhlihlakrgdlharrlvlrdlqdv
klvrklfdeiapryrdrqggytrvlklaerrrgdgaplalvelve
SCOP Domain Coordinates for d1gd8d_:
Click to download the PDB-style file with coordinates for d1gd8d_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gd8d_:
- d1gd8d_ is new in SCOP 1.57
- d1gd8d_ appears in SCOP 1.59
- d1gd8d_ appears in the current release, SCOPe 2.08
View in 3D
